PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_07698.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 334aa    MW: 37849.4 Da    PI: 6.5073
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_07698.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.26.7e-53211501129
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdeel+++yL++kv +  l    +i+evd++++ePw+Lp+++k +e+ewyf+s rd+ky+tg r+nrat++gyWkat
  Rsa1.0_07698.1_g00001.1  21 LPPGFRFHPTDEELITFYLAAKVFHGGLCG-IHIAEVDLNRCEPWELPEMAKMGEREWYFYSLRDRKYPTGLRTNRATTAGYWKAT 105
                              79*************************877.78***************9889999******************************* PP

                      NAM  87 gkdkevlsk..kgelvglkktLvfykgrapkgektdWvmheyrle 129
                              gkdkevls   +g+lvg+kktLvfykgrap+g kt+Wvmheyrle
  Rsa1.0_07698.1_g00001.1 106 GKDKEVLSGggGGALVGMKKTLVFYKGRAPRGLKTKWVMHEYRLE 150
                              ********9878889****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-6217171IPR003441NAC domain
PROSITE profilePS5100558.6321171IPR003441NAC domain
PfamPF023656.6E-2722149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010014Biological Processmeristem initiation
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MLAVEDVLNE LAGEERNDRG LPPGFRFHPT DEELITFYLA AKVFHGGLCG IHIAEVDLNR  60
CEPWELPEMA KMGEREWYFY SLRDRKYPTG LRTNRATTAG YWKATGKDKE VLSGGGGGAL  120
VGMKKTLVFY KGRAPRGLKT KWVMHEYRLE TDLSHRHTCK EEWVICRVFN KTGDRKNVGI  180
HNQISFLHNT SLSTTHQHHN HDLYHHLEIL PPLLEPSKTQ TNFPSLLYDD THQNYHNNLL  240
HGSSAHNVDG FKALISPAVS QLNGVIFSQE NSYYNNEEDN NFGVKTEQYS NGGNNDLDVR  300
DYLDNPFCPE AGYGLLGLSS SPGPLMLLDS PYVL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-502117415171Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00241DAPTransfer from AT1G76420Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ7039690.0HQ703969.1 Raphanus sativus CUP-SHAPED COTYLEDON 3 (CUC3) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009106303.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 3
RefseqXP_013717884.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 3
SwissprotQ9S8510.0NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3
TrEMBLF5B9T60.0F5B9T6_RAPSA; CUP-SHAPED COTYLEDON 3 (Fragment)
TrEMBLA0A078DF250.0A0A078DF25_BRANA; BnaA07g32710D protein
TrEMBLM4DGX40.0M4DGX4_BRARP; Uncharacterized protein
STRINGBra015750.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40028174
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76420.11e-163NAC family protein